Package: tmap 3.99.9003
tmap: Thematic Maps
Thematic maps are geographical maps in which spatial data distributions are visualized. This package offers a flexible, layer-based, and easy to use approach to create thematic maps, such as choropleths and bubble maps.
Authors:
tmap_3.99.9003.tar.gz
tmap_3.99.9003.zip(r-4.5)tmap_3.99.9003.zip(r-4.4)tmap_3.99.9003.zip(r-4.3)
tmap_3.99.9003.tgz(r-4.4-any)tmap_3.99.9003.tgz(r-4.3-any)
tmap_3.99.9003.tar.gz(r-4.5-noble)tmap_3.99.9003.tar.gz(r-4.4-noble)
tmap_3.99.9003.tgz(r-4.4-emscripten)tmap_3.99.9003.tgz(r-4.3-emscripten)
tmap.pdf |tmap.html✨
tmap/json (API)
NEWS
# Install 'tmap' in R: |
install.packages('tmap', repos = c('https://r-tmap.r-universe.dev', 'https://cloud.r-project.org')) |
Bug tracker:https://github.com/r-tmap/tmap/issues
Pkgdown:https://r-tmap.github.io
choropleth-mapsmapsspatialthematic-mapsvisualisation
Last updated 9 hours agofrom:1b3dca9137. Checks:OK: 7. Indexed: yes.
Target | Result | Date |
---|---|---|
Doc / Vignettes | OK | Dec 13 2024 |
R-4.5-win | OK | Dec 13 2024 |
R-4.5-linux | OK | Dec 13 2024 |
R-4.4-win | OK | Dec 13 2024 |
R-4.4-mac | OK | Dec 13 2024 |
R-4.3-win | OK | Dec 13 2024 |
R-4.3-mac | OK | Dec 13 2024 |
Exports:.TMAP.TMAP_GRID.TMAP_LEAFLETchart_savedata_classdata_typeformat_aes_resultsget_fact_levels_naget_scale_defaultslwd_to_mmmake_by_varsmarker_iconopt_tm_bubblesopt_tm_cartogramopt_tm_cartogram_dorlingopt_tm_cartogram_ncontopt_tm_dotsopt_tm_labelsopt_tm_linesopt_tm_markersopt_tm_polygonsopt_tm_rasteropt_tm_sfopt_tm_squaresopt_tm_symbolsopt_tm_textprovidersqtmrenderTmapshapeTMtheme_pstm_add_legendtm_basemaptm_borderstm_bubblestm_cartogramtm_cartogram_dorlingtm_cartogram_nconttm_chart_bartm_chart_boxtm_chart_donuttm_chart_heatmaptm_chart_histogramtm_chart_nonetm_chart_violintm_check_fixtm_compasstm_consttm_creditstm_dotstm_elementtm_element_listtm_extra_innner_margintm_facetstm_facets_fliptm_facets_gridtm_facets_hstacktm_facets_pagewisetm_facets_stacktm_facets_vstacktm_facets_wraptm_filltm_formattm_graticulestm_gridtm_grouptm_isotm_labelstm_labels_highlightedtm_layouttm_legendtm_legend_combinetm_legend_hidetm_linestm_logotm_markerstm_minimaptm_mouse_coordinatestm_optionstm_place_legends_bottomtm_place_legends_insidetm_place_legends_lefttm_place_legends_righttm_place_legends_toptm_plottm_plot_ordertm_polygonstm_postm_pos_auto_intm_pos_auto_outtm_pos_intm_pos_on_toptm_pos_outtm_rastertm_remove_layertm_rgbtm_rgbatm_scaletm_scale_asistm_scale_bartm_scale_bivariatetm_scale_categoricaltm_scale_continuoustm_scale_continuous_logtm_scale_continuous_log10tm_scale_continuous_log1ptm_scale_continuous_log2tm_scale_continuous_pseudo_logtm_scale_continuous_sqrttm_scale_discretetm_scale_intervalstm_scale_ordinaltm_scale_ranktm_scale_rgbtm_scale_rgbatm_scalebartm_seqtm_sftm_shapetm_squarestm_styletm_symbolstm_texttm_tilestm_titletm_title_intm_title_outtm_varstm_viewtm_xlabtm_ylabtmap_animationtmap_arrangetmap_design_modetmap_devel_modetmap_formattmap_format_addtmap_grobtmap_iconstmap_lasttmap_leaflettmap_modetmap_optionstmap_options_difftmap_options_modetmap_options_resettmap_options_savetmap_savetmap_styletmap_style_catalogtmap_style_cataloguetmap_tiptmapAddLayerOptionstmapChartBinnedtmapChartBinned_categoricaltmapChartBinned_numerictmapChartBinned2dtmapChartBinned2d_catcattmapChartBinned2d_numcattmapChartBinned2d_numnumtmapChartNonetmapChartPasstmapChartRawtmapChartRaw_nnatmapGetShapeMeta1tmapGetShapeMeta2tmapGpartmapGridLinestmapGridPolygonstmapGridRastertmapGridSymbolstmapGridTexttmapLeafletLinestmapLeafletPolygonstmapLeafletRastertmapLeafletSymbolstmapLeafletTexttmapModetmapOutputtmapProxytmapScaletmapScaleAsIstmapScaleAutotmapScaleBivariatetmapScaleCategoricaltmapScaleIntervalstmapScaleRanktmapSeqtmapShapetmapSplitShptmapSubsetShptmapTpartmapTransCartogramtmapTransCentroidtmapTransLinestmapTransPolygonstmapTransRastertmapUsrClstmapValuesBVV_bgcoltmapValuesBVV_coltmapValuesBVV_filltmapValuesCheck_angletmapValuesCheck_areatmapValuesCheck_bgcoltmapValuesCheck_bgcol_alphatmapValuesCheck_coltmapValuesCheck_col_alphatmapValuesCheck_filltmapValuesCheck_fill_alphatmapValuesCheck_fontfacetmapValuesCheck_ltytmapValuesCheck_lwdtmapValuesCheck_numtmapValuesCheck_shapetmapValuesCheck_sizetmapValuesCheck_skiptmapValuesCheck_texttmapValuesCheck_xmodtmapValuesColorize_angletmapValuesColorize_areatmapValuesColorize_bgcoltmapValuesColorize_bgcol_alphatmapValuesColorize_coltmapValuesColorize_col_alphatmapValuesColorize_filltmapValuesColorize_fill_alphatmapValuesColorize_fontfacetmapValuesColorize_ltytmapValuesColorize_lwdtmapValuesColorize_numtmapValuesColorize_shapetmapValuesColorize_sizetmapValuesColorize_skiptmapValuesColorize_texttmapValuesColorize_xmodtmapValuesCVV_angletmapValuesCVV_areatmapValuesCVV_bgcoltmapValuesCVV_bgcol_alphatmapValuesCVV_coltmapValuesCVV_col_alphatmapValuesCVV_filltmapValuesCVV_fill_alphatmapValuesCVV_fontfacetmapValuesCVV_ltytmapValuesCVV_lwdtmapValuesCVV_numtmapValuesCVV_shapetmapValuesCVV_sizetmapValuesCVV_skiptmapValuesCVV_texttmapValuesCVV_xmodtmapValuesCVV_ymodtmapValuesIsDiv_angletmapValuesIsDiv_areatmapValuesIsDiv_bgcoltmapValuesIsDiv_bgcol_alphatmapValuesIsDiv_coltmapValuesIsDiv_col_alphatmapValuesIsDiv_filltmapValuesIsDiv_fill_alphatmapValuesIsDiv_fontfacetmapValuesIsDiv_ltytmapValuesIsDiv_lwdtmapValuesIsDiv_numtmapValuesIsDiv_shapetmapValuesIsDiv_sizetmapValuesIsDiv_skiptmapValuesIsDiv_texttmapValuesIsDiv_xmodtmapValuesRange_angletmapValuesRange_areatmapValuesRange_bgcoltmapValuesRange_bgcol_alphatmapValuesRange_coltmapValuesRange_col_alphatmapValuesRange_filltmapValuesRange_fill_alphatmapValuesRange_fontfacetmapValuesRange_ltytmapValuesRange_lwdtmapValuesRange_numtmapValuesRange_shapetmapValuesRange_sizetmapValuesRange_skiptmapValuesRange_texttmapValuesRange_xmodtmapValuesScale_angletmapValuesScale_areatmapValuesScale_bgcoltmapValuesScale_bgcol_alphatmapValuesScale_coltmapValuesScale_col_alphatmapValuesScale_filltmapValuesScale_fill_alphatmapValuesScale_fontfacetmapValuesScale_ltytmapValuesScale_lwdtmapValuesScale_numtmapValuesScale_shapetmapValuesScale_sizetmapValuesScale_skiptmapValuesScale_texttmapValuesScale_xmodtmapValuesSubmit_angletmapValuesSubmit_areatmapValuesSubmit_bgcoltmapValuesSubmit_bgcol_alphatmapValuesSubmit_coltmapValuesSubmit_col_alphatmapValuesSubmit_filltmapValuesSubmit_fill_alphatmapValuesSubmit_fontfacetmapValuesSubmit_ltytmapValuesSubmit_lwdtmapValuesSubmit_numtmapValuesSubmit_shapetmapValuesSubmit_sizetmapValuesSubmit_skiptmapValuesSubmit_texttmapValuesSubmit_xmodtmapValuesSubmit_ymodtmapValuesVV_angletmapValuesVV_areatmapValuesVV_bgcoltmapValuesVV_bgcol_alphatmapValuesVV_coltmapValuesVV_col_alphatmapValuesVV_filltmapValuesVV_fill_alphatmapValuesVV_fontfacetmapValuesVV_ltytmapValuesVV_lwdtmapValuesVV_numtmapValuesVV_shapetmapValuesVV_sizetmapValuesVV_skiptmapValuesVV_texttmapValuesVV_xmodtoTitleCasetransform_valuesttmttmp
Dependencies:abindbase64encbslibcachemclassclassIntclicolorspacecols4allcrosstalkdata.tableDBIdichromatdigeste1071evaluatefarverfastmapfontawesomefsgeojsonsfgeometriesgluehighrhtmltoolshtmlwidgetsjquerylibjsonifyjsonliteKernSmoothknitrlabelinglatticelazyevalleafemleafglleaflegendleafletleaflet.providersleafsynclifecyclelwgeommagrittrMASSmemoisemimemunsellpngproxyR6rapidjsonrrappdirsrasterRColorBrewerRcpprlangrmarkdowns2sassscalessfsfheadersspspacesXYZstarsstringdistterratinytextmaptoolsunitsviridisLitewkxfunXMLyaml
Readme and manuals
Help Manual
Help page | Topics |
---|---|
Thematic Map Visualization | tmap-package tmap |
Spatial data of global land cover | land |
Spatial data of metropolitan areas | metro |
Netherlands datasets | NLD_dist NLD_muni NLD_prov |
Draw thematic map | knit_print.tmap print.tmap |
Quick thematic map plot | qtm |
Wrapper functions for using *tmap* in *shiny* | renderTmap tmapOutput tmapProxy tm_remove_layer |
Spatial data of rivers | rivers |
ggplot2 theme for proportional symbols | theme_ps |
Map component: manual legend | tm_add_legend |
Map layer: basemap / overlay tiles | tm_basemap tm_tiles |
Map layer: cartogram | opt_tm_cartogram opt_tm_cartogram_dorling opt_tm_cartogram_ncont tm_cartogram tm_cartogram_dorling tm_cartogram_ncont |
Legend charts | tm_chart tm_chart_bar tm_chart_box tm_chart_donut tm_chart_heatmap tm_chart_histogram tm_chart_none tm_chart_violin |
tmap options | tmap_options tmap_options_diff tmap_options_mode tmap_options_reset tmap_options_save tm_check_fix |
Map component: compass | tm_compass |
tmap function to define a constant visual value | tm_const |
Map component: (credits) text | tm_credits |
Specify facets | tm_facets tm_facets_flip tm_facets_grid tm_facets_hstack tm_facets_pagewise tm_facets_stack tm_facets_vstack tm_facets_wrap |
Coordinate grid / graticule lines | tm_graticules |
Coordinate grid / graticule lines | tm_grid |
Layer group control | tm_group |
Map layer: iso (contour) | tm_iso |
Legend | tm_legend tm_legend_combine tm_legend_hide |
Map layer: lines | opt_tm_lines tm_lines |
Map component: logo | tm_logo |
Map component: minimap | tm_minimap |
Map component: mouse coordinates | tm_mouse_coordinates |
tmap options | tm_options |
tmap layout: helper functions | tm_extra_innner_margin tm_place_legends_bottom tm_place_legends_inside tm_place_legends_left tm_place_legends_right tm_place_legends_top |
Plot mode options | tm_plot |
Determine plotting order of features | tm_plot_order |
Map layer: polygons | opt_tm_polygons tm_borders tm_fill tm_polygons |
Set the position of map components | tm_pos tm_pos_auto_in tm_pos_auto_out tm_pos_in tm_pos_on_top tm_pos_out |
Map layer: raster | opt_tm_raster tm_raster |
Map layer: rgb images | opt_tm_rgb tm_rgb tm_rgba |
Scales: automatic scale | tm_scale |
Scales: as is | tm_scale_asis |
Scales: bivariate scale | tm_scale_bivariate |
Scales: continuous scale | tm_scale_continuous tm_scale_continuous_log tm_scale_continuous_log10 tm_scale_continuous_log1p tm_scale_continuous_log2 tm_scale_continuous_pseudo_log tm_scale_continuous_sqrt |
Scales: discrete scale | tm_scale_discrete |
Scales: interval scale | tm_scale_intervals |
Scales: categorical and ordinal scale | tm_scale_categorical tm_scale_ordinal |
Scales: rank scale | tm_scale_rank |
Scales: RGB | tm_scale_rgb tm_scale_rgba |
Map component: scale bar | tm_scalebar |
Specify a numeric sequence | tm_seq |
Map layer: simple features | opt_tm_sf tm_sf |
Shape (spatial object) specification | tm_shape |
Layout options | tm_layout tm_style |
Map layer: symbols | opt_tm_bubbles opt_tm_dots opt_tm_markers opt_tm_squares opt_tm_symbols tm_bubbles tm_dots tm_markers tm_squares tm_symbols |
Map layer: text | opt_tm_labels opt_tm_text tm_labels tm_labels_highlighted tm_text |
Map component: title | tm_title tm_title_in tm_title_out |
tmap function to specify variables | tm_vars |
View mode options | tm_view |
Map: x and y labels | tm_xlab tm_ylab |
Create animation | tmap_animation |
Arrange small multiples in grid layout | knit_print.tmap_arrange print.tmap_arrange tmap_arrange |
Set the design mode | tmap_design_mode |
Set the development mode | tmap_devel_mode |
Deprecated: format | tmap_format tmap_format_add tm_format |
Specify icons | marker_icon tmap_icons |
Retrieve the last map to be modified or created | tmap_last |
Export tmap to the format of the used graphics mode | tmap_grob tmap_leaflet |
Set tmap mode to static plotting or interactive viewing | tmap_mode ttm ttmp |
Save tmap | tmap_save |
Set or get the default tmap style | tmap_style |
Create a style catalogue | tmap_style_catalog tmap_style_catalogue |
Print a random tip to the console | tmap_tip |
Stacking of tmap elements | +.tmap tmap-element |
World dataset | World |